PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009801284.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 264aa    MW: 29045.1 Da    PI: 8.2028
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009801284.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.67.4e-403293263
          zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63
                    ke+a++cprC+stntkfCyynnyslsqPryfCk+CrryWt+GG+lrnvPvGgg+rknk+sss
  XP_009801284.1 32 KEQAINCPRCNSTNTKFCYYNNYSLSQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRSSS 93
                    7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-271884IPR003851Zinc finger, Dof-type
PfamPF027019.7E-343490IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.1063690IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103874IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MDTSHWPQGI GLVKAVEPSK PVPTERKPRP QKEQAINCPR CNSTNTKFCY YNNYSLSQPR  60
YFCKTCRRYW TEGGSLRNVP VGGGSRKNKR SSSSSNNSSS STSSSYKKIP DLTIPTSSQN  120
PKIINEPHDL NLAFNPSATS NFSNISEFMA LPLMNPNSTT SFMSSIMPQL SDSNNIMYSS  180
SSTGLPNLHD LKPTLNFSLD GFDNNNGYGS LQGETAGAKL FFPLDDLKNV STPNDDHEFD  240
EQNRGQAAES HGFWNGMLGG GSSW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB9717080.0AB971708.1 Nicotiana tabacum NtBBF1 mRNA for Dof zinc finger protein, complete cds, cultivar: Samsun NN.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009801284.10.0PREDICTED: dof zinc finger protein DOF1.8-like
RefseqXP_016497460.10.0PREDICTED: dof zinc finger protein DOF1.8-like
TrEMBLA0A068PXR90.0A0A068PXR9_TOBAC; Dof zinc finger protein
STRINGSolyc03g082840.2.11e-92(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.11e-41Dof family protein